SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000445_2.0
Identity
ProteinMethionine sulfoxide reductase A (MsrA)
SpeciesCavia porcellus (Guinea Pig)
Protein IDSPP00000445
Protein release2.0
External IDNone
Transcript SPT00000437_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward (Reverse in the original sequence)
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000445_2.0 # Protein # Methionine sulfoxide reductase A (MsrA) # Guinea Pig (Cavia porcellus)
MLSGIARARQLLRGLLPGSRMGDSASTLVSPQEALPGRKEAISVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWILKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVIRVV
YQPEHISFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTCAAQMQAALQSKEDYQKS
LSAHGFGPITTDIREGQTFYYAEDYHQQYLSKIPDGYCGLRGTGISCPLGIKK#
Chart Advanced