SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000484_2.0
Identity
ProteinIodothyronine deiodinase (DI)
SpeciesCholoepus hoffmanni (Sloth)
Protein IDSPP00000484
Protein release2.0
External IDNone
Transcript SPT00000476_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000484_2.0 # Protein # Iodothyronine deiodinase  (DI) # Sloth (Choloepus hoffmanni)
SISILGNRPLVLNFGSCTUPSFLFKLDQFKRLVDDFSSIADFLIIYIEEAHASGTKRFPA
LTSSLLSLPAPK
Chart Advanced