SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000752_2.0
Identity
ProteinEukaryotic elongation factor (eEFsec)
SpeciesDipodomys ordii (Kangaroo rat)
Protein IDSPP00000752
Protein release2.0
External IDNone
Transcript SPT00000744_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000752_2.0 # Protein # Eukaryotic elongation factor (eEFsec) # Kangaroo rat (Dipodomys ordii)
LRRLPTGAQIIDLMMLVIDVTKGMQTQSAECLVIGQIACQKLVVVLNKVDLLAEGKRQAA
IDRMTRRMQKTLEGTKFQGTPVVPVAAKPGGPEAPDTEAPQGIPELIEVLSTQALPRGGR
RGQCWPCRAGLVMASGFSGLVMASGGLRAGDGEGVSGLVMVVRKVKSMQMFHTPVTSAMQ
GDRLGLCVTQFDPKLLERGLVCAPDTLRTLHAAIISVEKIPYFRGPLQTKAKFHITVGHE
TVMGRLLFFSLAPDGLDREPAPDSFDFSREYLFQEQYLSKDAAPAAPDSQADRAGRAPEG
GCPRQQWALVEFEKPITCPRLCLVIGSRLDADIHSNSCRLAFHGTLLHGLEDRNYTESFL
PTLRVYKLKHKHGVVDRVMDDYNVIGRSLFKKETNIQLFVGLEVTLSTGERGLIHSAFGQ
SGKFKIHIPGGLGPESKKTLAPALKKRVRPGLGEAARPEEGPERPEPQHVTLSLSFKRYV
FDPHKRMVQS
Chart Advanced