SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00000974_2.0
Identity
ProteintRNA Sec 1 associated protein 1 (SECp43)
SpeciesFelis catus (Cat)
Protein IDSPP00000974
Protein release2.0
External IDNone
Transcript SPT00000966_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00000974_2.0 # Protein # tRNA Sec 1 associated protein 1 (SECp43) # Cat (Felis catus)
IPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGD
LTPDVDDGMLYESSSKSTPPVGEASASAFVSYRGYGFVKFTDELEQKRALTECQGAVGLG
SKPLWKRLSTFVSFCFFLHLRSRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSY
SYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPL
DTVSSEIPAMM
Chart Advanced