SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00001328_2.0
Identity
ProteinSECIS binding protein 2 (SBP2)
SpeciesMacaca mulatta (Macaque)
Protein IDSPP00001328
Protein release2.0
External IDNone
Transcript SPT00001320_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00001328_2.0 # Protein # SECIS binding protein 2 (SBP2) # Macaque (Macaca mulatta)
MASEGPREPESEGIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFVQEPPVT
EQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYHYNHPSCYR
SFQTVKHQNENVCPLPQEMKALFKKKTYDEKKTYDQQKFDSERTDGTMSSEIKSARGSHH
LSIYAENSLKSDGYHKRTDRKSRIIAKNVSTSKPEFEFTTLDFPELQGAENNMSEIQKQP
KWGPVHSSSTDISLLREVVKPAAVLSKGEIVVKNNNPNESVTANAATNSPSCTRELSWTP
MGYVVRQTLSTELSPAPKNVTSMINLKTIASSADPKNVSIPSSEALSSDRSYNKEKHIVH
PTQKSKASQGSDLEQNEASRKSKKKKEKSTSKYKVLTVQEPPRIEDAEEFPNLAVASERR
DRIETPKFQSKQQPQDNFRNNVKKSQLPVQLDLGGMLTALEKKQHSQHAKQSSRPVVVSV
GAVPVLSKECTSGERGRRVSQMKTPHNPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKE
RQERKQQRLQENAVSPAFTSDDTQDGESGGDDQVPEQAEPSGPEGMDEPISTPAIEGKSE
EPPGTELQRDTEASHLAPNHATFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDR
MYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYA
CEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTMAARQAYKTMLE
NVQQELAGEPRPQAPPSPPTQGPSCPAEDGPPALTEKEEPHYIEIWKKHLEAYSPCALEL
EESLEASTSQMMNLNL
Chart Advanced