SelenoDB
Release 2.0
Chart Advanced
Protein Report for SPP00002360_2.0
Identity
ProteinSelenoprotein O (SelO)
SpeciesRattus norvegicus (Rat)
Protein IDSPP00002360
Protein release2.0
External IDNone
Transcript SPT00002352_2.0
Annotation
Prediction method(s)
Conceptual translation (Translate, Standard code with Sec) [Report annotation error]
OrientationForward
Structure gene structure

FeatureCol PromoterCol Coding exonCol Non coding exon (UTR)Col IntronCol SECIS
ResidueCol SecCol Cys or Other

Toolbox
Sequence
>SPP00002360_2.0 # Protein # Selenoprotein O (SelO) # Rat (Rattus norvegicus)
MASFRAAFGASLAVARTRPQCVGLELQSSAPWSAWAAAMEPTPRWLARLRFDNRALRALP
VETPPPGPEDSLSTPRPVPGACFSRARPAPLRQPRLVALSEPALALLGLEVSEEAEVEAE
AALFFSGNALLPGTEPAAHCYCGHQFGQFAGQLGDGAAMYLGEVCTAAGERWELQLKGAG
PTAFSRQADGRKVLRSSIREFLCSEAMFHLGIPTTRAGACVTSESTVMRDVFYDGNPKYE
KCTVVLRIAPTFIRFGSFEIFKPPDELTGRAGPSVGRNDIRVQMLDYVISSFYPEIQAAH
TCDTDNIQRNAAFFREVTRRTARMVAEWQCVGFCHGVLNTDNMSIVGLTIDYGPFGFLDR
YDPDHVCNASDNAGRYTYSKQPQVCRWNLQKLAEALEPELPLVLAEAILKEEFDTEFQRH
YLQKMRKKLGLVRVEKEDETLVAKLLETMHQTGADFTNTFCVLSSFPAEPSDTAEFLTQL
TSQCASLEELKLAFRPQMDPRQLSMMLMLAQSNPQLFALIGTQANVTKELERVEHQSRLE
QLSPSELQSKNRDHWETWLQEYRERLDKEKEGVGDIAAWQAERVRIMHANNPKYVLRNYI
AQKAIEAAENGDFSEVRRVLKLLESPYHSEEEATGPEAVARTTDEQSSYSSRPPLWAAEL
CVTUSS
Chart Advanced